PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_79356.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 122aa    MW: 12279.5 Da    PI: 6.1278
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_79356.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70283.74.4e-26356101154
        DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                    + ++P+evsseavfrcvr++ vd++++e+aYqtavsigGhvfkGiL+d G+++
  MLOC_79356.3   3 AADRFPREVSSEAVFRCVRLGPVDEADAEVAYQTAVSIGGHVFKGILHDVGPDT 56 
                   5678***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.2E-23555IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016243.4E-23654IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MMAADRFPRE VSSEAVFRCV RLGPVDEADA EVAYQTAVSI GGHVFKGILH DVGPDTSITR  60
TGHHAAEGSS PSTAAAGGAE GGSGSTGAAA VSSSAVVMDP YPTPGPYGAY GGAPFFHGHH  120
PR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3735250.0AK373525.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3033N03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974131.15e-50PREDICTED: protein SHI RELATED SEQUENCE 1-like
TrEMBLF2EBK05e-82F2EBK0_HORVD; Predicted protein (Fragment)
STRINGMLOC_79356.11e-79(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18120.12e-18SHI-related sequence 4